<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00973
Description |
Uncharacterized protein |
Sequence | MDPEGKKFGGGPRELTGAVDLISHFKLIPHYEFFCKRPLPVSIADTHYLHSVVGDTEVRKGDGMQLDELIQNTSFSRETSARIQPFDLDILKESFQLRETAPIDLPAAEKGIPTIAGKSKSEKDKEKKHKKHKDRDKDKDREHKKHKHRHKDRSKDKDKDKKKDKSGHRDSSADHSKKHHEKKRKHDGDDDANDVHKHKKSKHKSSRIDELGAIKVAG |
Length | 218 |
Position | Head |
Organism | Medicago truncatula (Barrel medic) (Medicago tribuloides) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Medicago.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -1.411 |
Instability index | 32.09 |
Isoelectric point | 9.51 |
Molecular weight | 24960.80 |
Publications | PubMed=22089132
PubMed=24767513
PubMed=30397259
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP00973
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.40| 16| 16| 123| 138| 1
---------------------------------------------------------------------------
122- 137 (31.37/10.41) EKDKEKKHKKHKDRDK
156- 171 (27.03/ 8.04) DKDKDKKKDKSGHRDS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.57| 13| 33| 138| 150| 2
---------------------------------------------------------------------------
138- 150 (24.89/ 9.62) DKDREHKKHKHRH
174- 186 (23.68/ 8.79) DHSKKHHEKKRKH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.84| 14| 18| 70| 87| 3
---------------------------------------------------------------------------
70- 87 (17.84/23.21) IQNTSFS.RETsAriqPFD
90- 104 (22.00/12.87) ILKESFQlRET.A...PID
---------------------------------------------------------------------------
|