<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00972
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MATPGMGMLDGGVPTAQPPGTDMTGICFRDQLWLNTYPLDRNLVFDYFALSPFYDWTSNNEQLRMRSHHPLDSSQLTKMIGIEYVLSEVMEPHLFIMKKQKRDSPDKVTPMLAYYILDGSIYQAPQLSNVFAARIGRALYYIEKAFTTAASKLEKIGYVDSENETTIPEPKVAKETIDLKEIKRVDHILASLQRKLPPAPPPPPFPEGYVPPSTAETEKGPETQEAAESLAPTVDPILDQGPAKRMKF |
| Length | 248 |
| Position | Head |
| Organism | Medicago truncatula (Barrel medic) (Medicago tribuloides) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Medicago.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.412 |
| Instability index | 57.60 |
| Isoelectric point | 5.33 |
| Molecular weight | 27789.56 |
| Publications | PubMed=22089132
PubMed=24767513
PubMed=30397259
|
Function
| Annotated function |
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP00972
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.16| 11| 29| 30| 40| 1
---------------------------------------------------------------------------
30- 40 (22.36/16.41) DQLWLNT.YPLD
61- 72 (16.80/10.55) EQLRMRShHPLD
---------------------------------------------------------------------------
|