Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MAALDNDQVRSLDQTRQLLLSLHTSLVALRSDISQNPQLPSWPALQTHANLISSNLQTITESLSRHRDAFSSAVVHPLPQFPAKERAFILETLLRTKFEPNIEEWVEEGEAVASRQHRPAQRGLTDADRDALWQWAPGAANAEARKQKWGADYTLEEKQNGIENVTTGLRRELIEPPDDEGAEDDDDDEEYDEVTDDENDAEDKMDVEQSKSEATPSSTEIKPPSLHTAQMPLATLHRFMTTGR |
Length | 244 |
Position | Head |
Organism | Exophiala aquamarina CBS 119918 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.820 |
Instability index | 60.13 |
Isoelectric point | 4.56 |
Molecular weight | 27432.75 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00968 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 65.06| 20| 37| 37| 58| 1 --------------------------------------------------------------------------- 37- 58 (29.22/21.86) PqLPSWPAlQTHANLISSNLQT 77- 96 (35.85/18.24) P.LPQFPA.KERAFILETLLRT --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DKMDVEQS 2) EEYDEVTD 3) GLRRELIEPPD 4) SLHTAQMPLATLHRFMTTG | 203 189 168 225 | 210 196 178 243 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab