<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00967
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSSLPQSTTIPPSPTSPPAFGLKRRRLSDNIPQSPISPPLMSVATKSYVASYGNSHDTDEVSGRSSPRSPRGSVSRAHQPASRPTPSLPTPANSVVGIPGLEMTEDIDSHRDKRPRLDADRDEEEDKMQVDTNSLFTNHDRQQDAGPSDEADKRALQPDSLRGSKNEMNTLEQQKDMGEPFLLCRSKFEPQRPNPQQHLLAVYGLGPLLRSVARTDPLSGEKINKLRKSYEGQIKSFELPGRNKAVRGERNADEDQPGPLRRMAGSAPWGLQTDEQWNSEHARFNIEMTSDLHAKVKQAMQMQPGAVRNNTYWEGELGLSDKPKINPLPQRDQSSQPVLSRIPNGIPRSLPQAAGEPKRQTRGKKRSYGDDSFVGYGEGYSDGDFSGDDGYQKKRKKVI |
| Length | 399 |
| Position | Head |
| Organism | Exophiala aquamarina CBS 119918 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.071 |
| Instability index | 62.89 |
| Isoelectric point | 9.07 |
| Molecular weight | 44254.66 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00967
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 84.84| 22| 25| 158| 182| 1
---------------------------------------------------------------------------
108- 128 (28.90/12.99) .DSHRDKRPR...LDADRDEE......EDKM
132- 156 (22.54/ 8.75) TNSLFTNH......DRQQDAGpsdeadKRAL
158- 182 (33.40/23.25) PDSLRGSKNEmntLEQQKDMG......EPFL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.76| 12| 20| 7| 18| 2
---------------------------------------------------------------------------
7- 18 (26.00/10.49) STTIPPSPTSPP
28- 39 (25.76/10.34) SDNIPQSPISPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.27| 12| 17| 64| 75| 3
---------------------------------------------------------------------------
64- 75 (21.50/ 9.38) RSSPRSPRGSVS
83- 94 (22.77/10.38) RPTPSLPTPANS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.90| 21| 322| 42| 63| 5
---------------------------------------------------------------------------
42- 63 (32.68/23.86) SVATKSYVaSYGNSHDTDEVSG
367- 387 (40.22/25.15) SYGDDSFV.GYGEGYSDGDFSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.62| 16| 20| 240| 255| 7
---------------------------------------------------------------------------
240- 255 (28.15/15.76) PGRNKAVRGER....NADED
257- 276 (23.47/12.03) PGPLRRMAGSApwglQTDEQ
---------------------------------------------------------------------------
|