Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSSLPQSTTIPPSPTSPPAFGLKRRRLSDNIPQSPISPPLMSVATKSYVASYGNSHDTDEVSGRSSPRSPRGSVSRAHQPASRPTPSLPTPANSVVGIPGLEMTEDIDSHRDKRPRLDADRDEEEDKMQVDTNSLFTNHDRQQDAGPSDEADKRALQPDSLRGSKNEMNTLEQQKDMGEPFLLCRSKFEPQRPNPQQHLLAVYGLGPLLRSVARTDPLSGEKINKLRKSYEGQIKSFELPGRNKAVRGERNADEDQPGPLRRMAGSAPWGLQTDEQWNSEHARFNIEMTSDLHAKVKQAMQMQPGAVRNNTYWEGELGLSDKPKINPLPQRDQSSQPVLSRIPNGIPRSLPQAAGEPKRQTRGKKRSYGDDSFVGYGEGYSDGDFSGDDGYQKKRKKVI |
Length | 399 |
Position | Head |
Organism | Exophiala aquamarina CBS 119918 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.071 |
Instability index | 62.89 |
Isoelectric point | 9.07 |
Molecular weight | 44254.66 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00967 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 84.84| 22| 25| 158| 182| 1 --------------------------------------------------------------------------- 108- 128 (28.90/12.99) .DSHRDKRPR...LDADRDEE......EDKM 132- 156 (22.54/ 8.75) TNSLFTNH......DRQQDAGpsdeadKRAL 158- 182 (33.40/23.25) PDSLRGSKNEmntLEQQKDMG......EPFL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 51.76| 12| 20| 7| 18| 2 --------------------------------------------------------------------------- 7- 18 (26.00/10.49) STTIPPSPTSPP 28- 39 (25.76/10.34) SDNIPQSPISPP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 44.27| 12| 17| 64| 75| 3 --------------------------------------------------------------------------- 64- 75 (21.50/ 9.38) RSSPRSPRGSVS 83- 94 (22.77/10.38) RPTPSLPTPANS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 72.90| 21| 322| 42| 63| 5 --------------------------------------------------------------------------- 42- 63 (32.68/23.86) SVATKSYVaSYGNSHDTDEVSG 367- 387 (40.22/25.15) SYGDDSFV.GYGEGYSDGDFSG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 51.62| 16| 20| 240| 255| 7 --------------------------------------------------------------------------- 240- 255 (28.15/15.76) PGRNKAVRGER....NADED 257- 276 (23.47/12.03) PGPLRRMAGSApwglQTDEQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FSGDDGYQKKRKKVI 2) PAFGLKRRRLSDNIPQ 3) SFVGYGEGYSD | 385 18 372 | 399 33 382 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab