<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00960
Description |
Uncharacterized protein |
Sequence | MSNDILTQLQTCYDQLLTQCFSTISYLSQRHPIIAPDADPNDPYTNPPATGGPSQTPNPDGTPMSAIQPGREDTERAPYPLRPVLPSTFSAAQRELAEDLVQKAQQIDTLISRLPGIGRDEEQQRREIEILNQKVRAMEEKRKAKRREMRDYVKRLDDVILGMSQSLNYHEANRPTP |
Length | 177 |
Position | Middle |
Organism | Exophiala aquamarina CBS 119918 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.868 |
Instability index | 66.08 |
Isoelectric point | 5.48 |
Molecular weight | 20071.33 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP00960
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.33| 18| 20| 40| 59| 1
---------------------------------------------------------------------------
40- 59 (31.64/19.11) PNDPYtnPPATGGPSQTPNP
63- 80 (33.69/15.10) PMSAI..QPGREDTERAPYP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.74| 20| 20| 107| 126| 2
---------------------------------------------------------------------------
107- 126 (31.42/19.61) IDTLISRLPGIGRDEEQQRR
128- 147 (28.31/17.08) IEILNQKVRAMEEKRKAKRR
---------------------------------------------------------------------------
|