<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00959
Description |
CMGC/CDK/CDK8 protein kinase |
Sequence | MAQQLRKTTQLSLVEDALRNLDKKQPGNSYTAKVKIGHKYNIIGFISSGTYGRVYKAVEKNPKGDLSSPVGATPTKELYAIKKFKPEKEGDNVQYTGLSQSAIREMSLCTELSHPNVVHLAEIILEDKCVFMVFEYCEHDLLQIIHHHTQPTRRPIPATMIKSILFQLLNGLFYLHQNWVIHRDLKPANIMVTSSGHVRIGDLGLARLFHKPLSSLYSGDKVVVTIWYRSPDLLLGARHYTPAIDLWAVGCIFAELLSLRPIFKGEETKMDSKKTVPFQRNQMGKIVEILGMPRRENWKGLVDMPEYAQLQSLILSRGSSGLYPGTTSSMNRNSNGNSGSGLETWYNNCLRHATYPSDKSPGQRGFQLLSELFEYDPEQRLTAEKALQHEYFKFADEGPNKGKIWVSNNCFEGLDEVYPHRRVSTETNDIGTGSLPGTKRGGLPDDSLLPAAKRR |
Length | 455 |
Position | Kinase |
Organism | Exophiala aquamarina CBS 119918 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.444 |
Instability index | 45.26 |
Isoelectric point | 9.10 |
Molecular weight | 51249.06 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP00959
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.72| 25| 199| 145| 174| 1
---------------------------------------------------------------------------
145- 174 (35.48/38.64) IHHHTQPTRRPiPATmiKSilFQLLNGLF.Y
350- 375 (43.24/27.01) LRHATYPSDKS.PGQ..RG..FQLLSELFeY
---------------------------------------------------------------------------
|