<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00938
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLQNVPHQIVQSPARLGLPNPNSPSLQNATPANLFFCKCPHLPNRSHWISAFRGSLPSFLSSQSQPLTSTAPDSYPSSSKEILALFTNLQTQLFEAVAELQEILDLQDGKQKLSHEIRSKDAAILALASKLKEAEQVLDNLVDDYSDYRRSKRSKSEDVAEDSSTTTVASQLKLSDILSYAHRISYTTFAPPEFGAGQAPLRGALPPAPQEEQMRASQLYAFADLDVGLPKTDEHKKKIIEPLIETPVGQPAEPNPLANLAGMQGLLPPNIAVPSGWKPGMPVELPSDLPILPPPGWKPGDPVALPPLDSLPVPPRIEEQQPQHIPPPMLTKAPEPIQVLHVQLDIDDDSSDYSSDVGSSDSED |
| Length | 364 |
| Position | Middle |
| Organism | Coffea canephora (Robusta coffee) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Gentianales> Rubiaceae> Ixoroideae> Gardenieae complex>
Bertiereae - Coffeeae clade> Coffeeae> Coffea.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.422 |
| Instability index | 78.47 |
| Isoelectric point | 4.81 |
| Molecular weight | 39570.18 |
| Publications | PubMed=25190796
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00938
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 91.38| 17| 17| 267| 283| 1
---------------------------------------------------------------------------
267- 283 (36.07/13.55) LPP..NIAV..PSGWKPGMPV
285- 303 (32.64/11.66) LPS..DLPIlpPPGWKPGDPV
305- 322 (22.67/ 6.16) LPPldSLPV..PPRIEEQQP.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.92| 28| 39| 77| 114| 2
---------------------------------------------------------------------------
77- 108 (38.98/45.47) SSSKEILALFTNLQtqlfEAVAELQEIL.DLQD
119- 147 (39.94/21.34) SKDAAILALASKLK....EAEQVLDNLVdDYSD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 95.56| 27| 37| 2| 30| 3
---------------------------------------------------------------------------
2- 30 (45.21/27.27) LQNVPHQIvqSPARLGLPNPNSPSLQNAT
42- 68 (50.36/25.36) LPNRSHWI..SAFRGSLPSFLSSQSQPLT
---------------------------------------------------------------------------
|