<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00919
Description |
Uncharacterized protein |
Sequence | MEDKAGTAGAVAVAGKTIQELAVEGQKHLEETIESAFQILSSMNDELCNPNLWSTNPNPNSSTAGAAASAAIANGIVNNGSTSAMSNGHHTASNGDVSSDSSSSSSHQLDIGVGVGALEDARMRYKSSVASLRSVLTAISNSQKVKASEMVSTSGSGSPTDQADIEKLEEQASALRKALVERNKYLKLLIDQQRDLISDICTWQSPCSV |
Length | 209 |
Position | Head |
Organism | Coffea canephora (Robusta coffee) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Gentianales> Rubiaceae> Ixoroideae> Gardenieae complex>
Bertiereae - Coffeeae clade> Coffeeae> Coffea.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.318 |
Instability index | 39.15 |
Isoelectric point | 4.95 |
Molecular weight | 21783.80 |
Publications | PubMed=25190796
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblPlants
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP00919
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.62| 15| 52| 97| 111| 2
---------------------------------------------------------------------------
97- 111 (25.73/13.30) VSSDSSSSSSHQLDI
151- 165 (26.89/14.19) VSTSGSGSPTDQADI
---------------------------------------------------------------------------
|