<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00912
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MATATYPPPPPFYRLYKKYSEDPKSAPEPPPPIEGNYQLFGATYTTDDVLPSLEEQGVRQLYPKGPNVDFKKELRALNRELQLHILELADILIERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILEIQIQRRKQAVEDIKRRREEAQRLLKEALGTLDGQ |
Length | 168 |
Position | Middle |
Organism | Coffea canephora (Robusta coffee) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Gentianales> Rubiaceae> Ixoroideae> Gardenieae complex>
Bertiereae - Coffeeae clade> Coffeeae> Coffea.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.682 |
Instability index | 74.00 |
Isoelectric point | 8.78 |
Molecular weight | 19513.13 |
Publications | PubMed=25190796
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP00912
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.93| 27| 44| 74| 106| 2
---------------------------------------------------------------------------
74- 106 (36.86/39.28) LRALNRELQ........LHILEladILIERPSQyarRVEDI
113- 147 (41.07/25.83) LHHLLNSLRphqaratlIHILE...IQIQRRKQ...AVEDI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.76| 10| 19| 31| 40| 3
---------------------------------------------------------------------------
31- 40 (20.69/13.91) PPIE..GNYQLF
51- 62 (14.07/ 7.40) PSLEeqGVRQLY
---------------------------------------------------------------------------
|