<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00889
Description |
Uncharacterized protein |
Sequence | MDNHVDSLNNAYEEFVAAAANVLEAKESSEGQKTAATDAALENFKQRWELFRVACDQAEEFVESVKQRIGSECLVDEATGSVAGKPGQAATSGLPPISAVRLEQMSKAVRWLVIELQHGGTAGCSSHSHSSAPFDARFSEDAAQ |
Length | 144 |
Position | Tail |
Organism | Coffea canephora (Robusta coffee) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Gentianales> Rubiaceae> Ixoroideae> Gardenieae complex>
Bertiereae - Coffeeae clade> Coffeeae> Coffea.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.353 |
Instability index | 57.56 |
Isoelectric point | 4.75 |
Molecular weight | 15397.77 |
Publications | PubMed=25190796
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP00889
No repeats found
|