<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00874

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMVELAPKKRRRLDSTTTTTTPSYASARYPPSCLLSNLIHRQAPHQLSSSIQSVVVTTPPKPATPAIHAFTGDHYALDLVSKSTTLLNKSPIRLAEQFHDQCLITHLVWNQRGTTLASADENGKIALWELGTSSDQWTLAYSVNLQQPPAGILWLNTDRVYQLSHDQQKFVRMPMVGPRNPYGYFAFVVVTVHGQVSVHYQRGGKIFSSFSTTLPNTGRMGAGRADVGCFGMNLASSDNWYRISHASMIIGQDGNIYLATHRANTSPKSVQIYRLSIRFPGRMNEGGIFCQPLATLRLTQPSLASSLGDFAKSSSIAVSHLQLSNQKDNVQLTLAFGAENDGSYSSFIGKWALQQKEIQISGDAIARDSFSGTTMTSNYLVLDFVDGVSVSDRFISSMTHTRHGALVVGLSDGSVHIEYRDDGDFGLLRGRGSCESSIGPTFWQAAGPRTYLNGDPDPVAGLALSPNETHIFCILSSNKLGVIRATDIRNDHDETETLSTISRLLKLSLLNETDDLDLISELIRVNAISGHDDATESLVLDVIKSYHVYCHQDQSEPLLVSPTTESSSKSSGSLEWSLPQRGRAYGLSLGVFRRLSSTKVQYTNLCKAIQLPIVLECFIGSCKSDYADITKVLDSNTIVDGKATLEFDTDSLWSLMSLTNWTLDFMRWTLRKWNMLFNCRRPKDSSDISARPCHAVLLLHEESRDALSKLLVMVNEFVHYTNSASFELPNVPESLPLLLRYAKNVLSSEPVALKDVLAFLTAIKSEDLGVQDRWALLLGSKLPSDKVDRLRVITREFAEKCGQPAIYLERDSSDIIDVIQKRRIPPFTKHLWTCVRCHQYSIPTHGHPHLTANDPCLRALWNRSIGRRCVCGGLFAECL
Length878
PositionTail
OrganismLichtheimia corymbifera JMRC:FSU:9682
KingdomFungi
LineageEukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina> Mucoromycetes> Mucorales> Lichtheimiaceae> Lichtheimia.
Aromaticity0.08
Grand average of hydropathy-0.184
Instability index42.99
Isoelectric point7.58
Molecular weight97330.49
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP00874
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      87.37|      26|      34|     240|     266|       1
---------------------------------------------------------------------------
  240-  266 (44.08/33.36)	YRISHASMIIGQDGNIY...LATHRAnTSP
  272-  300 (43.29/27.64)	YRLSIRFPGRMNEGGIFcqpLATLRL.TQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.56|      16|      38|     482|     497|       3
---------------------------------------------------------------------------
  482-  497 (28.14/18.36)	IRATDIRNDHDETETL
  522-  537 (27.42/17.71)	IRVNAISGHDDATESL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      95.02|      29|     178|     553|     621|       5
---------------------------------------------------------------------------
  113-  142 (45.57/10.72)	TTLASADENGKIAlWELGTSSDQWTLAYSV
  562-  590 (49.45/65.73)	TTESSSKSSGSLE.WSLPQRGRAYGLSLGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.97|      20|      36|       5|      24|       7
---------------------------------------------------------------------------
    5-   24 (34.80/21.18)	APKK.RRRLDSTTTTTTPSYA
   42-   62 (31.17/18.25)	APHQlSSSIQSVVVTTPPKPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     111.49|      36|      38|     703|     738|       8
---------------------------------------------------------------------------
  703-  738 (58.19/40.41)	RDALSKLLVMVNEFVHYTNSASFELPNVPESLPLLL
  742-  777 (53.30/36.37)	KNVLSSEPVALKDVLAFLTAIKSEDLGVQDRWALLL
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP00874 with Med16 domain of Kingdom Fungi

Unable to open file!