<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00864
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | METSLRDRVDSLLTEYSQLTRQFFQSLTAIAENTSTTTDPLQQAPDQLVKRITDVDARLQSALEEIEQHQTRQQRIIAVQDEIQQHQAALLSLVERLNDARETLDKELTQASKEQKSIQFADKTNVDFSDILSYASKLSKYTSAPPGFDQMSNDFKVDFEKPYPDEDRMRRGLLYRQYAGTHVLPNITDETVEHLSMASSEDEERRGSAGAADGAPGNKPATEEAQDNFWILDLNPDLPS |
| Length | 240 |
| Position | Middle |
| Organism | Lichtheimia corymbifera JMRC:FSU:9682 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina>
Mucoromycetes> Mucorales> Lichtheimiaceae> Lichtheimia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.780 |
| Instability index | 46.11 |
| Isoelectric point | 4.57 |
| Molecular weight | 27152.54 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00864
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 104.40| 38| 40| 58| 97| 1
---------------------------------------------------------------------------
58- 97 (48.61/32.94) RlQSALEEIEQhQTRQQRIIAVQDEIQQHQAALLSLVERL
101- 138 (55.79/29.38) R.ETLDKELTQ.ASKEQKSIQFADKTNVDFSDILSYASKL
---------------------------------------------------------------------------
|