<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00860
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MDINDLHPPDDYTHRFFIWHEWIQANGPLTSENVFDYFATSMFYDKQSNNQVLRMQTMHTGVPVKDEAAELRRFTGVEFAVVHAQPPSFFVIQKRERLSPDEVRPLAAYFVMNNRIYQSPDVYTVLSNRLLTSVSALQSSIDILRKHRPDYTPRTGFVWPITDPSVLETHKKRDSEAILVEADGDSEMPQEKQPDIPKRQQNNMLLMHAMSTTAAHSKMSFTAAAVAQNTEGLGPETPISTTMRSSATPAPAIQEIGTKAASSNPQEPSKGPIGGGKKKKKRTSLAPPPAPS |
| Length | 292 |
| Position | Head |
| Organism | Galerina marginata (strain CBS 339.88) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Strophariaceae> Galerina.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.570 |
| Instability index | 63.18 |
| Isoelectric point | 7.15 |
| Molecular weight | 32588.48 |
| Publications | PubMed=24958869
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00860
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 113.48| 35| 35| 218| 252| 2
---------------------------------------------------------------------------
218- 252 (59.15/29.48) KMSFTAAAVAQNTEGLGP.ETPISTTMRSSATPAPA
255- 290 (54.32/26.59) EIGTKAASSNPQEPSKGPiGGGKKKKKRTSLAPPPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.67| 14| 137| 1| 15| 3
---------------------------------------------------------------------------
1- 15 (25.98/18.45) MDINDLHPPdDYTHR
141- 154 (28.69/15.48) IDILRKHRP.DYTPR
---------------------------------------------------------------------------
|