<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00856
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MDEDNAELRNPFPSPPSHYTKYTTLNLNLLALLKERAPDDPSPNQHEVLNDQNDVPDWPLVQLEKPRVDWILEEPDAYYDVYGDRWFVKEKIPSLAELGGNQLYPTDPTIGKDRRPALRSVLRSLLVTYSSLTGSLLAPPPVSPEIPPEWQRHVEWINVLSQNLMAAANDLRPVQARGNLEAMMRRQLELRKEETKNLHEKCDILGARLGELRGSIQKVLKDSQSVRVYLCS |
| Length | 232 |
| Position | Middle |
| Organism | Galerina marginata (strain CBS 339.88) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Strophariaceae> Galerina.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.610 |
| Instability index | 56.22 |
| Isoelectric point | 5.35 |
| Molecular weight | 26525.82 |
| Publications | PubMed=24958869
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00856
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.07| 17| 32| 98| 116| 1
---------------------------------------------------------------------------
98- 116 (28.03/21.42) LGGNQLYPtdPTIGKDRRP
132- 148 (32.04/17.97) LTGSLLAP..PPVSPEIPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 94.93| 24| 33| 29| 52| 2
---------------------------------------------------------------------------
9- 21 (19.21/ 6.97) .......RNP....FPSPPSHYT...K
29- 52 (42.09/23.25) LLALLKERAP...DDPSPNQHEVLNDQ
60- 85 (33.63/17.23) LVQLEKPRVDwilEEPD.AYYDVYGDR
---------------------------------------------------------------------------
|