<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00855
Description |
Uncharacterized protein |
Sequence | MSLSTLDDWSSTILQHDPMQLYRAKRDRNHRSVSSKYNILGFISSGTYGRVYKAQSLEDEGTIHAIKKFKPDKEGDVVMYTGISQSAIREIALNREIDHENIVALKEVILEDKSIYMVFEYAEHDFLQVIHHHSQTLRSPITLTVLKSLTYQLLNGLIYLHASHILHRDLKPANILITSSGIIKIGDLGLARLIHEPLQPLFAGDKVVVTIWYRAPELLMGAKHYTKAIDCWAVGCVVAELVSLRPIFKGEEAKLDSKKNVPFQRDQLLKIFEVIGTPDEKDWPGVVDMPEYQSMKRLDHFQNRLADWCNSRMRSPLAYDLLRQLFIYDPDARLTAKDALQHKWFQDDPKPTWKYVSIPSPSRLHIQASPSSSNTHLTNPPPLSQRIRISRTPPNPPAQTHHTRRSSVHGT |
Length | 411 |
Position | Kinase |
Organism | Galerina marginata (strain CBS 339.88) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Strophariaceae> Galerina.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.382 |
Instability index | 50.54 |
Isoelectric point | 8.98 |
Molecular weight | 46986.35 |
Publications | PubMed=24958869
|
Function
Annotated function |
|
GO - Cellular Component | euchromatin GO:0000791 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:EnsemblFungi
|
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IEA:EnsemblFungi
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP00855
No repeats found
|