<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00854
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MGFTGLARWLNAPGSGISLVRENLLVNHNAQYRGRWLLSVKSYRSSLGQIPGSHVPSERNMYALTLDENVFILLEDPAAPSRADVLAAAPPGQEAAYLQSPSHYRNTFLTLKPPGGLEQLLDQIKARWISVRQTSSSTGPKTQLGGGQQLLIDGQTFAIGTDWLVRIGNVILAGGGIKGMLLEAEYLPLPVFHSAIADGTSELLSNLLTSILPNIRDAKTVAVTISDAQWEDVLWDREEEGKGTKNVDPDAQDNDPYAWDSNDITDWRQGDWVGVDRDQRSAFLIMGALRSEGLL |
| Length | 295 |
| Position | Head |
| Organism | Galerina marginata (strain CBS 339.88) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Strophariaceae> Galerina.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.240 |
| Instability index | 49.97 |
| Isoelectric point | 4.90 |
| Molecular weight | 32246.91 |
| Publications | PubMed=24958869
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00854
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.64| 18| 21| 74| 92| 1
---------------------------------------------------------------------------
74- 92 (26.88/15.57) LEDPaAPSRADVLAAAPPG
98- 115 (32.76/15.72) LQSP.SHYRNTFLTLKPPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.46| 11| 28| 145| 155| 4
---------------------------------------------------------------------------
145- 155 (20.22/10.62) GGG.QQLLIDGQ
174- 185 (15.24/ 6.49) GGGiKGMLLEAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.61| 18| 89| 31| 51| 5
---------------------------------------------------------------------------
31- 51 (26.46/29.51) QYRGRWlLSVKSYRSSLGqiP
123- 140 (34.15/23.70) QIKARW.ISVRQTSSSTG..P
---------------------------------------------------------------------------
|