<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00850
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MDTDTTASPSPDPKAANRARFELELEFVQALANPFYLHSLAQQNILEQPAFIHFLEYLLYFKEKDYARFIHYPHALHHLELLQHAQFRSQMKKDEFLREYLHQKQFDHWRTWREPSAINSSNPEVVPETDAGNKPTL |
| Length | 137 |
| Position | Middle |
| Organism | Galerina marginata (strain CBS 339.88) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Strophariaceae> Galerina.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.699 |
| Instability index | 51.72 |
| Isoelectric point | 5.95 |
| Molecular weight | 16250.05 |
| Publications | PubMed=24958869
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00850
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 102.45| 31| 37| 36| 66| 1
---------------------------------------------------------------------------
36- 66 (55.01/31.76) YLHSLAQQNILEQPAFIHFL...EYL.LYFKEKDY
72- 106 (47.44/26.57) YPHALHHLELLQHAQFRSQMkkdEFLrEYLHQKQF
---------------------------------------------------------------------------
|