<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00849
Description |
Uncharacterized protein |
Sequence | MMMGETVELKNEIERLEEVHGRLQRVRQIPRVLLQMKGNEKVGDEFGVVKEIGELVQSAAVQAALSRAQESLKADAGGLGTEHRRLKRKKSKKGETSRRTRSPEGYVAEERKGTTVLPVCSEDAVKMEQLGAWARAYNAAHKNKIRIRGDMVRLAIPDVMTVYMGVGRGEGDRVVVETIRAFGPREQMEGHGQSGYTVYQELSQQMNKMLEMAGQAKLQQAVGLVEAYEDVFVGRCAVCGRVVAGEGHVPGVVRRWTGSGWAGEHIGCSP |
Length | 270 |
Position | Tail |
Organism | Galerina marginata (strain CBS 339.88) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Strophariaceae> Galerina.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.459 |
Instability index | 44.81 |
Isoelectric point | 9.14 |
Molecular weight | 29743.80 |
Publications | PubMed=24958869
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP00849
No repeats found
|