| Description | Mediator of RNA polymerase II transcription subunit 22 |
| Sequence | MSHSRGLPQSKEALLKSYTTRLKDDVKSMLENFEEIVKLAKGENETQLSKMTQSEQDTYEMHVRAANIVRAGESLMKLVSDIKQYLILNDFPSVNEAITQNSKLFRTKQAECDQKLMSLRDDMAADLYDLEEEYYTSIYK |
| Length | 140 |
| Position | Head |
| Organism | Zootermopsis nevadensis (Dampwood termite) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae> Termopsidae> Zootermopsis. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.666 |
| Instability index | 51.32 |
| Isoelectric point | 5.12 |
| Molecular weight | 16199.19 |
| Publications | PubMed=24845553 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP00843 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) EEIVKLAKGEN 2) LLKSYTTRL | 34 14 | 44 22 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab