<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00843
| Description |
Mediator of RNA polymerase II transcription subunit 22 |
| Sequence | MSHSRGLPQSKEALLKSYTTRLKDDVKSMLENFEEIVKLAKGENETQLSKMTQSEQDTYEMHVRAANIVRAGESLMKLVSDIKQYLILNDFPSVNEAITQNSKLFRTKQAECDQKLMSLRDDMAADLYDLEEEYYTSIYK |
| Length | 140 |
| Position | Head |
| Organism | Zootermopsis nevadensis (Dampwood termite) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae>
Termopsidae> Zootermopsis.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.666 |
| Instability index | 51.32 |
| Isoelectric point | 5.12 |
| Molecular weight | 16199.19 |
| Publications | PubMed=24845553
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00843
No repeats found
|