Description | Mediator of RNA polymerase II transcription subunit 22 |
Sequence | MSHSRGLPQSKEALLKSYTTRLKDDVKSMLENFEEIVKLAKGENETQLSKMTQSEQDTYEMHVRAANIVRAGESLMKLVSDIKQYLILNDFPSVNEAITQNSKLFRTKQAECDQKLMSLRDDMAADLYDLEEEYYTSIYK |
Length | 140 |
Position | Head |
Organism | Zootermopsis nevadensis (Dampwood termite) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae> Termopsidae> Zootermopsis. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.666 |
Instability index | 51.32 |
Isoelectric point | 5.12 |
Molecular weight | 16199.19 |
Publications | PubMed=24845553 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00843 No repeats found |
MoRF Sequence | Start | Stop |
1) EEIVKLAKGEN 2) LLKSYTTRL | 34 14 | 44 22 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab