<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00836
| Description |
Mediator of RNA polymerase II transcription subunit 29 |
| Sequence | MNIPPMQQQGPGVIPQVPQQPGPGTPQQAQQMQPQIQQAQEKFDNISKVKSLIAPLRESLALTLKTAAQTLHQNSLVDVGSLKGVDVPVPRFDRNMEEFYSICDQIELHLKTSIECLAQGAASQRYLSLPVALTRTDPLPNQEGAALTYPQYLATVRSQVGFAKEVHDMLMGAAQNVSSGE |
| Length | 181 |
| Position | Tail |
| Organism | Zootermopsis nevadensis (Dampwood termite) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae>
Termopsidae> Zootermopsis.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.335 |
| Instability index | 51.95 |
| Isoelectric point | 5.60 |
| Molecular weight | 19730.27 |
| Publications | PubMed=24845553
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP00836
No repeats found
No repeats found
|