<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00820
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MQREEKQQDAALEAIIMRVNDLKNSIGSMLVKLEHEYETLNWPTFLDNFALMSGHLTTLSKMLSHDKSPPLRNLTVLPLLLSPDRDEELLRLTEGRVPTFSHDLVPDYLRTKPEPDVERQMIQMEHKAANLAYESAQKQVTAYSKVVSHVWDIVSKAREEWETESGSRSGGAQTSSVSDTHVLVAAVGMGKGLKPMVQQPVSSGPQGMMVAPVGRPGAGGPQQPGSGPMNPNQPGQMGPMGKAPSAIKTNIKAASQIHPYGR |
| Length | 262 |
| Position | Head |
| Organism | Zootermopsis nevadensis (Dampwood termite) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae>
Termopsidae> Zootermopsis.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.487 |
| Instability index | 39.51 |
| Isoelectric point | 6.72 |
| Molecular weight | 28609.35 |
| Publications | PubMed=24845553
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00820
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.74| 12| 17| 205| 221| 1
---------------------------------------------------------------------------
205- 221 (16.54/18.85) PqgmmVAPvGRPGAGGP
228- 239 (26.20/11.64) P....MNP.NQPGQMGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.16| 17| 17| 62| 78| 2
---------------------------------------------------------------------------
58- 75 (26.44/14.26) TLSkMLSHDKSPPLRNLT
76- 93 (24.72/12.93) VLPlLLSPDRDEELLRLT
---------------------------------------------------------------------------
|