<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00818
Description |
Cyclin-C |
Sequence | MAGNFWESSHHQQWLLDRQDLIRERQQDLSVLTEEEYQKIFIFFSNLIQILGEQLKLRQQVIATATVFFKRFYARNSLKCIDPLLLAPTCVFLASKVEEFGVISNSRLITTCQNVVKNKFSYAYSQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLQLIQDIGQEDQLLALAWRVVNDSLRTDVCLLYPPYQIALGCLQIACVILQKDLKSWFAELNVDIEKIQEIARYVINLFELWKSYDEKKDIQSLLAKMPKPKTQPSR |
Length | 266 |
Position | Kinase |
Organism | Zootermopsis nevadensis (Dampwood termite) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae>
Termopsidae> Zootermopsis.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.082 |
Instability index | 55.88 |
Isoelectric point | 6.00 |
Molecular weight | 31303.99 |
Publications | PubMed=24845553
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP00818
No repeats found
|