<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00816
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MMMADQFRKAEQYSPKSSPRGARSPVVSRQDSTGTLKTTISLGKNPSIVHSGPFYLMKEPPDVKDLTGATNLMEHYRLEHSYNKFSGKKVKEQLSSFLPYLPGMIDTPGHQDNSSLRSVIEKPPIGGKELLPLTSVQLAGFRLHPGPLPEQYRCVNQTPQRKHKNKHKKHKHKAGETPSQETQVTEVGQDTHEKKHKKQKRHDEEKERKKRKKEKKRKKQKHSPEHSGGLTPSQHSSG |
| Length | 238 |
| Position | Head |
| Organism | Zootermopsis nevadensis (Dampwood termite) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blattoidea> Termitoidae>
Termopsidae> Zootermopsis.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.290 |
| Instability index | 55.61 |
| Isoelectric point | 10.00 |
| Molecular weight | 27028.45 |
| Publications | PubMed=24845553
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00816
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 77.38| 14| 18| 192| 205| 1
---------------------------------------------------------------------------
163- 176 (25.85/12.17) HKNKHKKHKHKAGE
192- 205 (27.68/13.53) HEKKHKKQKRHDEE
213- 225 (23.86/10.68) KEKKRKKQK.HSPE
---------------------------------------------------------------------------
|