Description | Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGFTGLARWVNAPVHGSLSIISNNILENYNGKIVGNWNITIKAFRLPMPPFRDMPVPDRIMCTLQMNDSVFVLVEDSVSPERAMVVDPANSGDSFLQSCTHYRTTLVTVRPPMALEQLISQLKSRWVAARQSTSGGAQRNQAMSSQQLTIEGMVFAIGTDWLVRVGNVMLSTREMKGLIIEAEYLPVGRLHSPTVDGTSELLSNMLTALLPPRPDAKTLAVTSNDSQWAGVLSVREDDEAARQQPPKESDVPVEDEDDIYAYGDDPPPPTKGDWFGIDRDRRSAYLVMGGLRSEGLL |
Length | 297 |
Position | Head |
Organism | Pleurotus ostreatus PC15 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Pleurotaceae> Pleurotus. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.234 |
Instability index | 63.14 |
Isoelectric point | 4.93 |
Molecular weight | 32745.89 |
Publications | PubMed=24958869 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00805 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 59.04| 15| 21| 237| 257| 1 --------------------------------------------------------------------------- 243- 257 (27.51/17.26) QQPPKESDVPVEDED 266- 280 (31.53/ 9.58) PPPPTKGDWFGIDRD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 51.39| 16| 21| 198| 215| 2 --------------------------------------------------------------------------- 198- 215 (23.49/19.68) TSEllSNMLTALLPPRPD 222- 237 (27.90/16.80) TSN..DSQWAGVLSVRED --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 29.84| 9| 21| 157| 166| 3 --------------------------------------------------------------------------- 157- 166 (13.43/11.67) IGTDWLvRVG 180- 188 (16.41/ 8.98) IEAEYL.PVG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DVPVEDEDDIYAYGDDP 2) PPTKGDWFGIDRDRRSAYLVMGGLRSEGLL | 250 268 | 266 297 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab