Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MDINDLHPQDDHGHRFFIWHEWLQAYGPLTAENAFDYFTSSMFYDKQSNNQVLRMQTMHTGMPLLNEAEELRRFTGVEFALVHAEPPSLFIIHKRERLSPDEVRPLAAYFIANNRIYQAPDIYTVLSNRLLATLHSLQNSLNILRRHRPDYTPRTGFIWPIADPSIPDDSHPKPTVDADGDQEMGTAESDSQKVTGKKALTEVSAGPKKQQNTMLLFNAMRTTAVHSKVTPPSVPAAAENVEMGTPAPFPGFRAPATPVTPASDTIPSVPQKDSGLAEQPKGIPGAGKKKRKSE |
Length | 294 |
Position | Head |
Organism | Pleurotus ostreatus PC15 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Pleurotaceae> Pleurotus. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.567 |
Instability index | 48.75 |
Isoelectric point | 6.42 |
Molecular weight | 32746.59 |
Publications | PubMed=24958869 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00804 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 98.52| 29| 32| 222| 251| 1 --------------------------------------------------------------------------- 222- 251 (48.93/31.88) TTAVHSKVTPPSVPAAAENVEMgTPAPFPG 257- 285 (49.59/27.55) TPVTPASDTIPSVPQKDSGLAE.QPKGIPG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 204.30| 63| 70| 37| 105| 2 --------------------------------------------------------------------------- 39- 110 (94.53/53.91) TSSMFYDKQSNNQVLRMQTMHTGMPLLNEAEELRRFTGvEFAlvhaePPSLFIIHKRERLSPDEVRPlaaYF 112- 174 (109.77/51.18) ANNRIYQAPDIYTVLSNRLLATLHSLQNSLNILRRHRP.DYT.....PRTGFIWPIADPSIPDDSHP...KP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KDSGLAEQPKGIPGAGKKKRKSE 2) TGFIWPIA | 272 155 | 294 162 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab