<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00797
| Description |
Uncharacterized protein |
| Sequence | MSKSLEAAALMIAKEVVDNGPMELRDLFSLATSSTSPECVLQLTESPMITLAKGDTLVHIQPTAIAFWEKLGSGPKGGKKDVTAYTLFQEVDKSHRSSVANWLRNLSSE |
| Length | 109 |
| Position | Kinase |
| Organism | Pleurotus ostreatus PC15 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Pleurotaceae> Pleurotus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.127 |
| Instability index | 45.75 |
| Isoelectric point | 5.66 |
| Molecular weight | 11823.41 |
| Publications | PubMed=24958869
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP00797
No repeats found
No repeats found
|