<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00796
Description |
Uncharacterized protein |
Sequence | MSKSLEAAALMIAKEVVDNGEWALCWFANVQATAHLPQAEAWHADIHFIAHLLSRLPNVQGPMELRDLFSLATSSTSPERVLQLTESPMITLAKGDTLVHIQPTAIAFWEKLGSGPKGGKKDVTAYALFQEVNESHRSSVANWLRNLSSE |
Length | 150 |
Position | Kinase |
Organism | Pleurotus ostreatus PC15 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Pleurotaceae> Pleurotus.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.081 |
Instability index | 42.77 |
Isoelectric point | 5.84 |
Molecular weight | 16491.61 |
Publications | PubMed=24958869
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP00796
No repeats found
No repeats found
|