<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00781
| Description |
Mediator of RNA polymerase II transcription subunit 9 |
| Sequence | MDHPYTGGSWTMIPNVPSHSNSPAHSNQDQFYLHQQQSQQQQQQPQFNQFQQQQQFQQQQQQQQQQFQQQQQQQQQRLIQQQPPQQNQHHQSLASHFHLLHLVENLAEVIENGTRDQHSDALVNELNNHFEKCQQLLNSISSSINSKSMTVEGQKRKLEESEQLLNQRRDLMAKYRNSVEELIKSEP |
| Length | 187 |
| Position | Middle |
| Organism | Jatropha curcas (Barbados nut) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Jatropheae>
Jatropha.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.357 |
| Instability index | 70.99 |
| Isoelectric point | 6.09 |
| Molecular weight | 22111.85 |
| Publications | PubMed=24837971
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00781
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.23| 14| 15| 39| 53| 1
---------------------------------------------------------------------------
39- 53 (28.34/ 7.87) QQQQQQPQfNQFQQQ
57- 70 (30.89/ 6.14) QQQQQQQQ.QQFQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.90| 20| 26| 119| 138| 2
---------------------------------------------------------------------------
119- 138 (34.83/22.76) SDAL.VNELNNHFEKCQQLLN
146- 166 (28.07/16.95) SKSMtVEGQKRKLEESEQLLN
---------------------------------------------------------------------------
|