<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00768
| Description |
Uncharacterized protein |
| Sequence | MDTNNWTPTGQGAEPTMDAGDWRAQLQPDSRQRIVNKIMETLKRHLPFSGQEGLEELKKIAVRFEEKIYTAAASQPDYLRKISLKMLTMESKSQNPMPNSLPPNASGNSNRAPDPGDAKKAELEELTREIMELILEPEELYKDVEVVVCTSSSNMEFR |
| Length | 158 |
| Position | Tail |
| Organism | Jatropha curcas (Barbados nut) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Jatropheae>
Jatropha.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.768 |
| Instability index | 46.59 |
| Isoelectric point | 4.97 |
| Molecular weight | 17868.03 |
| Publications | PubMed=24837971
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP00768
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.22| 17| 47| 24| 40| 1
---------------------------------------------------------------------------
24- 40 (30.47/25.31) AQLQPDSRQRIVNKI..ME
72- 90 (25.75/20.32) AASQPDYLRKISLKMltME
---------------------------------------------------------------------------
|