<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00743
Description |
Uncharacterized protein |
Sequence | MEDNVMSSITLSKTTHELALEGQKHLEETIQAAYQIPSSMNDELCDPRLWSTTSSANSSTINTSTTSPITIMAMLLLMEATTWTVAALVLPLLG |
Length | 94 |
Position | Head |
Organism | Jatropha curcas (Barbados nut) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Jatropheae>
Jatropha.
|
Aromaticity | 0.03 |
Grand average of hydropathy | 0.100 |
Instability index | 37.72 |
Isoelectric point | 4.35 |
Molecular weight | 10199.55 |
Publications | PubMed=24837971
|
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP00743
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.55| 13| 14| 65| 77| 1
---------------------------------------------------------------------------
65- 77 (21.73/12.55) TTSPITIMAMLLL
81- 93 (21.82/12.62) TTWTVAALVLPLL
---------------------------------------------------------------------------
|