<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00736

Description Uncharacterized protein
SequenceMGDGNSTTSNRSIATNTNNSEKPEWLQQYNLIGKIGEGTYGLVFLAKTKSNPNRGKSIAIKKFKQSKDGDGVSPTAIREIMLLREISHENVVKLVNVHINHADMSLYLAFDYAEHDLYEIIRHHRDKGSHIINQYTVKSLLWQLLNGLNYLHSNWIIHRDLKPSNILVMGEGDEHGVVKIADFGLARIYQAPLKPLSDNGVVVTIWYRAPELLLGAKHYTSAVDMWAVGCIFAELLTLKPLFQGAEAKSTPNPFQIDQLDKIFKVLGHPTIEKWPTLANLPHWQSDLQHIQGHKYENPGLHNVVHLSPKSPPYDLLSKMLEYDPRKRITAAQALEHEYFRIEPLPGRNTLVPSQPGEKVINYPIRPVDTNTDFEGTTSLQPPQPVSSGNAVSGGMAGAHGVANRSAPRTMPIGMQRMQTHPMAAYNIASQAGMGGGMNPAGIPMPRGVAQPHQQQHLRRKDPPGLGTSYPPQQKSRRQ
Length478
PositionKinase
OrganismJatropha curcas (Barbados nut)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Jatropheae> Jatropha.
Aromaticity0.07
Grand average of hydropathy-0.480
Instability index40.09
Isoelectric point9.29
Molecular weight53181.08
Publications
PubMed=24837971

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP00736
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.43|      26|      37|     375|     411|       1
---------------------------------------------------------------------------
  393-  423 (35.83/32.57)	GGMAGahGVANRSAPrtMP.................iGMQRMQT.HPMA
  431-  475 (34.60/15.45)	AGMGG..GMNPAGIP..MPrgvaqphqqqhlrrkdppGLGTSYPpQQKS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      89.73|      28|      42|     167|     196|       2
---------------------------------------------------------------------------
  167-  196 (44.47/40.60)	LVMGEGDEHGVVKIADFGLarIYQA..PLKPL
  212-  241 (45.26/33.84)	LLLGAKHYTSAVDMWAVGC..IFAEllTLKPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     112.40|      33|      38|     312|     345|       3
---------------------------------------------------------------------------
  312-  345 (52.74/37.47)	PYDLLSKMLEYdPRKRITAAQALEHEYFRIEPLP
  352-  384 (59.66/37.86)	PSQPGEKVINY.PIRPVDTNTDFEGTTSLQPPQP
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP00736 with CDK8 domain of Kingdom Viridiplantae

Unable to open file!