<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00734
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MDSSQNAAVGTGGNGMLPAQVNDMAAATAVDDPKQNLNQVINSIQKTLGLLHQLYLTVSSFNTASQLPLLQRLNGLVVELDNMVKLSEKCDIQVPMEVLNLIDEGENPDEFTRNVINSCIAKNQVTKGKTDAFKSLRKHLLEELEQAFPDEVESYREIRTISAAESKRLAQAQSSLPNGDMKVKTEL |
| Length | 187 |
| Position | Middle |
| Organism | Jatropha curcas (Barbados nut) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Jatropheae>
Jatropha.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.345 |
| Instability index | 29.16 |
| Isoelectric point | 4.89 |
| Molecular weight | 20512.03 |
| Publications | PubMed=24837971
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00734
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.84| 11| 23| 44| 54| 1
---------------------------------------------------------------------------
44- 54 (18.38/11.68) IQKTLGLLHQL
70- 80 (17.46/10.81) LQRLNGLVVEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.29| 11| 20| 100| 111| 2
---------------------------------------------------------------------------
100- 111 (16.06/16.74) NLIDEGeNPDEF
123- 133 (19.22/13.71) NQVTKG.KTDAF
---------------------------------------------------------------------------
|