<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00717
Description |
Uncharacterized protein |
Sequence | MDDQEQQDQQHQVDQQMQSVQQQAEIEDMIACVNVMDDALLPCLTELDLNKAIMPDFEAPLTDFDEPAVQPAVETELQASDDFPPPLDHQKLYFRLTIVKEPRHEIDAMEEELKIKDELVQKQEKVIQELKKELRDRLDKHNAELERV |
Length | 148 |
Position | Head |
Organism | Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.794 |
Instability index | 59.59 |
Isoelectric point | 4.28 |
Molecular weight | 17305.25 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP00717
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.93| 16| 16| 52| 67| 1
---------------------------------------------------------------------------
44- 60 (23.13/11.12) LTELDlNKAIMPDFEAP
61- 76 (28.80/15.30) LTDFD.EPAVQPAVETE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.00| 17| 19| 98| 114| 2
---------------------------------------------------------------------------
98- 114 (27.81/17.98) I....VKEPRHEIDAMEEELK
115- 135 (20.19/11.25) IkdelVQKQEKVIQELKKELR
---------------------------------------------------------------------------
|