<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00710

Description Uncharacterized protein (Fragment)
SequenceMNNNNNNNSSSTPNPNANTNNKDSEEDLAAQPVETVIKPDKSDTLSSAAAAEEEASAKSDDPMDEDSVTPATVFCIRLKQPRSNLQHKMSVPELCRNFSAVAWCGKLNAIACASETCARIPSSNANTPFWIPIHIVIPERPTECAVFNVIADCPRDSVQFIEWSPTSCPRALLIANFYGRVTIWTQPSHGPANLVRDASCWQREHEWRQDIAVVTKWLSGVSPYRWLSSKSTSPLNAKSIFEEKFLSQNSQTSDRWPNFLCVCSVFSSGSVQLNWSQWPPSQNGAASKWFPTAKGLLGAGPSGIMAADVIITDSGAMHVAGVPIVNPSTVVVWEVTPGPGNGFQAAPKTTTSNGVPPSLSPPKWAGFAPLAAYLFSWQEYLLSEAKQGRKLTDQNFSDAITLHCSPVSNFSAYVSPEAAAQSAATTTWGSGVTAVAFDPTRGGSVIAVVIVE
Length452
PositionTail
OrganismCitrus sinensis (Sweet orange) (Citrus aurantium var. sinensis)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
Aromaticity0.08
Grand average of hydropathy-0.217
Instability index46.38
Isoelectric point5.49
Molecular weight48632.95
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP00710
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.64|      18|      23|     234|     256|       1
---------------------------------------------------------------------------
  235-  256 (26.90/27.29)	LNAKSIFEEKFLSQN.SQtsdrW
  260-  278 (28.74/12.31)	LCVCSVFSSGSVQLNwSQ....W
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      87.28|      18|      20|     163|     180|       2
---------------------------------------------------------------------------
  141-  155 (24.32/10.32)	...PTECAVFNVI..ADC.PR
  163-  180 (36.09/18.55)	WS.PTSCPRALLI..ANFYGR
  184-  203 (26.87/12.10)	WTqPSHGP.ANLVrdASCWQR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.28|      18|      21|     328|     347|       4
---------------------------------------------------------------------------
  328-  347 (30.62/17.62)	STVVVWEVTPGPGNGFqaAP
  352-  369 (36.66/16.31)	SNGVPPSLSPPKWAGF..AP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP00710 with Med16 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MNNNNNNNSSSTPNPNANTNNKDSEEDLAAQPVETVIKPDKSDTLSSAAAAEEEASAKSDDPMD
1
64










Molecular Recognition Features






MoRF SequenceStartStop




1) DLAAQPVETVIKP
27
39