<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00702
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MDGPVGGSRASGGNGMVSNQANDTTTVAADDPKQNLNQVINSVQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVSELDNMVKLSEKCNIQVPTEVLNLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFKSLRKHLLDELEQTFPDEVEAYREIRANSAAEAKRLAQSQSMLPNGDVKVKSEL |
Length | 186 |
Position | Middle |
Organism | Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.460 |
Instability index | 30.01 |
Isoelectric point | 5.24 |
Molecular weight | 20282.59 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP00702
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.36| 15| 17| 47| 61| 1
---------------------------------------------------------------------------
47- 61 (25.85/18.54) LGLLHQLYLTVSSFN
66- 80 (24.52/17.26) LPLLQRLNSLVSELD
---------------------------------------------------------------------------
|