<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00698
| Description |
Uncharacterized protein (Fragment) |
| Sequence | SENDAVGQDLQRQLEAAEKELKQVQELFSQAADNCLNLKKPN |
| Length | 42 |
| Position | Middle |
| Organism | Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.981 |
| Instability index | 38.30 |
| Isoelectric point | 4.55 |
| Molecular weight | 4714.14 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP00698
No repeats found
No repeats found
|