<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00696
| Description |
Uncharacterized protein |
| Sequence | MRLKLVGTVLQNSEREVFRLALKAFTDQKKRFFPHLDDRVHDQSTEPESKKHCVPQALPASNQEELSDCKTLSDVLMRLEKEVPNLKIFTYERLDWLKRASSLPSSANESPLELLKEHNFHSSSKLRPGLQNTVAADKVSVIELLFPSIFRAIVSLHPVGTIEPDAVAFFSPDEGGNYIHARGSSVYHVFRHITEHAGTALQFFLGIRTETSLYFLLHWICSYQTLFSKVCSKCGRLLAMDKRLALLLPPVSRPYRHFFPTVTSSAQLISSTNEQSSDVVNAYHIGCFSEDAQ |
| Length | 293 |
| Position | Tail |
| Organism | Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.217 |
| Instability index | 48.01 |
| Isoelectric point | 7.71 |
| Molecular weight | 33147.49 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP00696
No repeats found
|