<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00696
Description |
Uncharacterized protein |
Sequence | MRLKLVGTVLQNSEREVFRLALKAFTDQKKRFFPHLDDRVHDQSTEPESKKHCVPQALPASNQEELSDCKTLSDVLMRLEKEVPNLKIFTYERLDWLKRASSLPSSANESPLELLKEHNFHSSSKLRPGLQNTVAADKVSVIELLFPSIFRAIVSLHPVGTIEPDAVAFFSPDEGGNYIHARGSSVYHVFRHITEHAGTALQFFLGIRTETSLYFLLHWICSYQTLFSKVCSKCGRLLAMDKRLALLLPPVSRPYRHFFPTVTSSAQLISSTNEQSSDVVNAYHIGCFSEDAQ |
Length | 293 |
Position | Tail |
Organism | Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.217 |
Instability index | 48.01 |
Isoelectric point | 7.71 |
Molecular weight | 33147.49 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP00696
No repeats found
|