<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00687
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MATAAYPPPPPYYRLYKDYLQNPNSAPEPPPPIEGTYICFGGNYTTDDVLPSLEEQGVRQLYPKGPNIDFKKELRSLNRELQLHILELSDVLVERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQRRLKESLGTLEGQ |
| Length | 168 |
| Position | Middle |
| Organism | Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.734 |
| Instability index | 80.08 |
| Isoelectric point | 8.65 |
| Molecular weight | 19548.07 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP00687
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.94| 12| 19| 5| 16| 1
---------------------------------------------------------------------------
5- 16 (27.81/12.61) AYPPPPPYYRLY
26- 37 (26.14/11.50) APEPPPPIEGTY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.25| 27| 45| 74| 117| 2
---------------------------------------------------------------------------
74- 106 (36.44/47.59) LRSLN.RELQLHILELSdvlVERPSQyarRVEDI
120- 147 (43.81/18.59) LRPHQaRATLIHILELQ...IQRRKQ...AVEDI
---------------------------------------------------------------------------
|