Description | Uncharacterized protein |
Sequence | MRQLTYRRKLYGPQPGPLAEGKSVKRSRTQKDYSNSGKGGVKKWLPISGHRRTTNSFWTKKTWMWRNLLTEKRASLLKITSSLRCRCPTIYRNLAQHVKVRQRVVATAVTYMRRCYTRKSMTEYDPHLVAPTCLYLASKAEESTVQARLLVFYIKKIYSDEKYRYEVKDILEMEMKILEALNYYLVVFHPYRSLVQFLQDAGMNDINMTHLS |
Length | 212 |
Position | Kinase |
Organism | Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus. |
Aromaticity | 0.11 |
Grand average of hydropathy | -0.549 |
Instability index | 38.95 |
Isoelectric point | 10.06 |
Molecular weight | 25032.96 |
Publications |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro |
GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW cell division GO:0051301 IEA:UniProtKB-KW regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00685 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) MRQLTYRRKLYGP 2) VKKWLPI | 1 41 | 13 47 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab