| Description | Uncharacterized protein |
| Sequence | MRQLTYRRKLYGPQPGPLAEGKSVKRSRTQKDYSNSGKGGVKKWLPISGHRRTTNSFWTKKTWMWRNLLTEKRASLLKITSSLRCRCPTIYRNLAQHVKVRQRVVATAVTYMRRCYTRKSMTEYDPHLVAPTCLYLASKAEESTVQARLLVFYIKKIYSDEKYRYEVKDILEMEMKILEALNYYLVVFHPYRSLVQFLQDAGMNDINMTHLS |
| Length | 212 |
| Position | Kinase |
| Organism | Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus. |
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.549 |
| Instability index | 38.95 |
| Isoelectric point | 10.06 |
| Molecular weight | 25032.96 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro |
| GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW cell division GO:0051301 IEA:UniProtKB-KW regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP00685 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) MRQLTYRRKLYGP 2) VKKWLPI | 1 41 | 13 47 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab