<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00620
Description |
Uncharacterized protein |
Sequence | MSDPIGLADILGGRVGALRAATEALMVELSSLHGGGSGAKDEDPASLSVATTTLKNRLDRVQTNLNVLRKFSPEFEDKTKNIDAVSQTQRNLMLEYYWKTQIHEMAGKGANVWLAQMTEWFPRMEYVAAPGASLQPGGGHTEKVKAVMTVNERFVPKPTKRARMLVFDEQGDVQPVDLNEMMDYIMRRNKSIKFWKHTETTRGGRRVIKSISCEVNKEMMVYMSFCPAIPEGGPNGESGVAASPMTPSTPNSPAYHRSRATRAAKLKAKKIVAKKPRRDDMMTKAKMAAEEATKIEQEELRKLIIDAKETGKEQELAKAAGLQVTKYIDRVSILPPNEDAPLGAWSSSKHGVFEQITLHARKALHYFRVHHPETSFYHFFSWLANYEKLYNTPCMACKKILAKNASDSAFVPPTFRDYATGLPYHTSCI |
Length | 429 |
Position | Tail |
Organism | Saprolegnia parasitica (strain CBS 223.65) |
Kingdom | Oomycetes |
Lineage | Eukaryota> Sar> Stramenopiles> Oomycota> Saprolegniales> Saprolegniaceae>
Saprolegnia.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.476 |
Instability index | 49.32 |
Isoelectric point | 9.33 |
Molecular weight | 47928.58 |
Publications | PubMed=23785293
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP00620
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.23| 25| 31| 271| 297| 2
---------------------------------------------------------------------------
271- 297 (36.68/33.45) IVAKKPRRDDMMTKAkmAAEEATK.IEQ
305- 330 (35.55/24.60) IDAKETGKEQELAKA..AGLQVTKyIDR
---------------------------------------------------------------------------
|