<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00619
Description |
Uncharacterized protein |
Sequence | MKEPLERLLKAVQSLSPKSLSASVSEISSALKTVDAISGTACNDYEVDVDENLASETRCCMRGWNFSFQCGRSSEKKMKHKRNAIALDETDILKPSAGQIWDTDTTRIITRRRIEV |
Length | 116 |
Position | Tail |
Organism | Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.484 |
Instability index | 53.30 |
Isoelectric point | 7.65 |
Molecular weight | 12979.63 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP00619
No repeats found
No repeats found
|