| Description | Uncharacterized protein |
| Sequence | MSNANSEKDRALQSIRSRADHLRHTITQLESRLAWYPLTQWPYFLSQFQVISKQLENIMTLKDDEELPESMHHFVCMPRMSTPNPADIPLLLRTREDPEMEKADEELLASERVNPLKRKASWTWEELEGQKLAHTDMVETLEKAFKEASDVLLKEIRVGKFQEKVKPVSTQSSVYKYMETGQWTN |
| Length | 185 |
| Position | Head |
| Organism | Saprolegnia parasitica (strain CBS 223.65) |
| Kingdom | Oomycetes |
| Lineage | Eukaryota> Sar> Stramenopiles> Oomycota> Saprolegniales> Saprolegniaceae> Saprolegnia. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.736 |
| Instability index | 48.75 |
| Isoelectric point | 5.62 |
| Molecular weight | 21679.42 |
| Publications | PubMed=23785293 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP00615
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.80| 17| 18| 90| 107| 3
---------------------------------------------------------------------------
90- 106 (28.83/17.84) LLLRTREDPEMEKADEE
131- 147 (24.97/10.12) KLAHTDMVETLEKAFKE
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) IPLLLR 2) VYKYME | 88 174 | 93 179 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab