Description | Uncharacterized protein |
Sequence | MSNANSEKDRALQSIRSRADHLRHTITQLESRLAWYPLTQWPYFLSQFQVISKQLENIMTLKDDEELPESMHHFVCMPRMSTPNPADIPLLLRTREDPEMEKADEELLASERVNPLKRKASWTWEELEGQKLAHTDMVETLEKAFKEASDVLLKEIRVGKFQEKVKPVSTQSSVYKYMETGQWTN |
Length | 185 |
Position | Head |
Organism | Saprolegnia parasitica (strain CBS 223.65) |
Kingdom | Oomycetes |
Lineage | Eukaryota> Sar> Stramenopiles> Oomycota> Saprolegniales> Saprolegniaceae> Saprolegnia. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.736 |
Instability index | 48.75 |
Isoelectric point | 5.62 |
Molecular weight | 21679.42 |
Publications | PubMed=23785293 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00615 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.80| 17| 18| 90| 107| 3 --------------------------------------------------------------------------- 90- 106 (28.83/17.84) LLLRTREDPEMEKADEE 131- 147 (24.97/10.12) KLAHTDMVETLEKAFKE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IPLLLR 2) VYKYME | 88 174 | 93 179 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab