<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00610

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMPLMLESGMNGSMQVDQLDVDDLFGDGVGLSLHTARPPTKHLRQRIDELRTRGCCQGIAWSRSGAIASISPDGKTLEARFLRSHPDDGKWGLSEPTKVDLITINASSPIVHLAWASTTSPELAVIDATGRVAILTFSVTLNRPFATRKWDHDPSDDLHAIVGSYWLPLAPQAKQYYVSHGPAVKDGNQYRYESSFVHAYGPWHPNPSKSALLCVTTNGHLKMFWAQNNNKIEETTLELESVNSSDDLITHAALHSDKSNLWIALATTSKQLRLVRVGINWGLPQSQSDNKPPPGSQALNPTLQEKHVAITSWLPSGSSTTPVDSAANQLTHLEILPSTLDHTGQGWAPLIILAVRTFLPTPNTPYQETQSIIDKWEVLNDQAQSLHPAFEQLGSRRNSTGAGPAPTSRLKKHDPVIINKVIIGVHTLQFGRVICLAFSDGSVEYRDRFTLQEIYNEMNLDRVMTLNQVGFTFQDESPCLQMAFSPTNCSIVKIQDDGKAKWSKLHYPLGDIGNSNQDAPYAATLAALTVAASTATFNNINYDDILAVARPYADKKRFTFDWINEIVRMLKVPVDYSEDTHHDSLVRNSSLQMCLSILNHLGYKGMFQPRSFGGKFAMLALNARNVVILITIASNTPVNIREKLSPLDEHEVVDALASCAKWSLDLLSWLTDSLFALLDDPQFLALLTPQRFSEMSAYLQSRSDVSLHLLLCSSTRGFLSAVCRRILHLEILSNRAIEFYERRAAMQNATDPSSQAKSLHVVLYKAYQKMQRVTSGSLIKVQEFDRLLTVLNNDIRSAYQSSLASLAAKNPPGPGGQKAIDAQIKNAQVHCELNMLLASSPPPAFHPVLLKFFSSDLKAYRAQADPSKLFFAHFDLLEIDDDRRTLATRKARGQYIDVFKRVELVAPPAHGKKEGDEAKMAQWRRCVRCSAVMEDVFGSRPGFTFVLAQQRKCSCGGHWGILPKGALMI
Length968
PositionTail
OrganismColletotrichum sublineola (Sorghum anthracnose fungus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum> Colletotrichum graminicola species complex.
Aromaticity0.08
Grand average of hydropathy-0.223
Instability index44.20
Isoelectric point7.87
Molecular weight107348.14
Publications
PubMed=24926053

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP00610
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     109.48|      31|      95|     810|     848|       1
---------------------------------------------------------------------------
  291-  321 (56.98/30.58)	PPPGSQ.ALNPTLQEKHVAITSWLPSGSSTTP
  811-  842 (52.50/42.81)	PGPGGQkAIDAQIKNAQVHCELNMLLASSPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      96.25|      26|      93|     378|     418|       3
---------------------------------------------------------------------------
  323-  348 (48.42/19.79)	DSAANQLTHLEILPSTLDHTGQGWAP
  380-  405 (47.82/42.97)	DQAQSLHPAFEQLGSRRNSTGAGPAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      95.56|      26|      30|     900|     925|       5
---------------------------------------------------------------------------
  900-  925 (47.91/28.73)	RVELVAPPAHGKKEGDEAKMAQWRRC
  927-  952 (47.66/28.54)	RCSAVMEDVFGSRPGFTFVLAQQRKC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.32|      26|      30|     646|     673|       6
---------------------------------------------------------------------------
  646-  673 (37.42/34.45)	LDEHEVVdALASCAKWSlDLLSWL...TD.SL
  677-  706 (35.90/22.61)	LDDPQFL.ALLTPQRFS.EMSAYLqsrSDvSL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP00610 with Med16 domain of Kingdom Fungi
Unable to open file!