Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDKVIDARFERVEKALANLIESVSKYHPHPKQALDLYEADNDLAKGLDEVQTHQKNHIRLQQLRATTSSLDTQIRETLQSLATTRKDITTTQITVYPDGPKYPVKYDELLNYARRISKTTLPPAALVNAGGPTTGGGTPGPDLNASMTTNPNTPGASGLQSQPVSAAPTPSQTQTPGPSGAPISSPLQDALQTTQQTAATSGATSLPDGLRNHLNPHLNASFIPWPNEFHIRSGAMAVYQDLSDKGIDPRGYDPQQIAEAKRKEEEERRAREEQEKLENERKDREYREKMEKIRREQQEAYRRDSVAAGAGASSAGKSKQFQFTSLMDDDDDDE |
Length | 334 |
Position | Middle |
Organism | Colletotrichum sublineola (Sorghum anthracnose fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum> Colletotrichum graminicola species complex. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.943 |
Instability index | 50.05 |
Isoelectric point | 5.52 |
Molecular weight | 36833.19 |
Publications | PubMed=24926053 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00606 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 92.66| 20| 20| 153| 172| 1 --------------------------------------------------------------------------- 123- 141 (26.19/12.53) .PAALVNA.GGPTTGGGTPGP 153- 172 (35.77/19.76) TPGASGLQ.SQPVSAAPTPSQ 175- 195 (30.70/15.93) TPGPSGAPiSSPLQDALQTTQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 71.92| 15| 15| 267| 281| 3 --------------------------------------------------------------------------- 248- 262 (23.89/13.67) DPRGYDPQQIAEAKR 267- 281 (24.17/13.90) ERRAREEQEKLENER 283- 297 (23.87/13.65) DREYREKMEKIRREQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AGKSKQFQFTSLMDDDDDDE 2) KIRREQQEAYRRDSVAAGA | 315 292 | 334 310 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab