<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00606
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDKVIDARFERVEKALANLIESVSKYHPHPKQALDLYEADNDLAKGLDEVQTHQKNHIRLQQLRATTSSLDTQIRETLQSLATTRKDITTTQITVYPDGPKYPVKYDELLNYARRISKTTLPPAALVNAGGPTTGGGTPGPDLNASMTTNPNTPGASGLQSQPVSAAPTPSQTQTPGPSGAPISSPLQDALQTTQQTAATSGATSLPDGLRNHLNPHLNASFIPWPNEFHIRSGAMAVYQDLSDKGIDPRGYDPQQIAEAKRKEEEERRAREEQEKLENERKDREYREKMEKIRREQQEAYRRDSVAAGAGASSAGKSKQFQFTSLMDDDDDDE |
| Length | 334 |
| Position | Middle |
| Organism | Colletotrichum sublineola (Sorghum anthracnose fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum>
Colletotrichum graminicola species complex.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.943 |
| Instability index | 50.05 |
| Isoelectric point | 5.52 |
| Molecular weight | 36833.19 |
| Publications | PubMed=24926053
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00606
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 92.66| 20| 20| 153| 172| 1
---------------------------------------------------------------------------
123- 141 (26.19/12.53) .PAALVNA.GGPTTGGGTPGP
153- 172 (35.77/19.76) TPGASGLQ.SQPVSAAPTPSQ
175- 195 (30.70/15.93) TPGPSGAPiSSPLQDALQTTQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 71.92| 15| 15| 267| 281| 3
---------------------------------------------------------------------------
248- 262 (23.89/13.67) DPRGYDPQQIAEAKR
267- 281 (24.17/13.90) ERRAREEQEKLENER
283- 297 (23.87/13.65) DREYREKMEKIRREQ
---------------------------------------------------------------------------
|