<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00596
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MYELFLTTLVDDDDIQAACSVLGGLCAMPAWQSLHRVLYFKGPAKPGGISNQNSIVKTPRKDIQLLWKDLHQQLSRQSYILQARYEVFKDKDFGPTAPEVDFNARPGTLRWTDFPDPPQNRSLVTQRKKTEIWDQKNLMSVMRDNNYQFKSEAVEETYQFFREDVEFCLSRHYILQMNGDNGPLTQTAPWDTMSPADPGRRWMFLIKVHVHQDNKPDEILKAHEQLANIRRELEGVFDFKMFDRRIHDTRVAVEVRNAPAPLPQVMTVTDQR |
Length | 272 |
Position | Head |
Organism | Colletotrichum sublineola (Sorghum anthracnose fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum>
Colletotrichum graminicola species complex.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.628 |
Instability index | 54.55 |
Isoelectric point | 6.39 |
Molecular weight | 31711.69 |
Publications | PubMed=24926053
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP00596
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.45| 19| 89| 92| 111| 1
---------------------------------------------------------------------------
92- 111 (36.42/25.82) DFGP...TAP.EVDFNARPGTlRW
180- 202 (32.03/17.98) DNGPltqTAPwDTMSPADPGR.RW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.67| 11| 150| 71| 91| 3
---------------------------------------------------------------------------
71- 82 (17.09/11.40) HQQLSRQsYILQ
166- 176 (22.58/18.42) EFCLSRH.YILQ
---------------------------------------------------------------------------
|