<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00576

Description "Kinase protein with adenine nucleotide alpha hydrolases-like domain, putative"
SequenceMAPHFSDESNVPANTTAVAIDRDKNSPHAVRWAIDHLVITNPLIILVHVRHKNQGEGESDYDINQLFIPFRGYCARKGIQMREVILEDTDISKALVDYISKNLINSMVLGAASRNAISRKFKHDVPTTLIKSAPEFCSVYVISKGKILTVRTAQRPVANTATPPKAPSAGMPPQIPLDQIEDDGIRGQYTRGALRNAGSERLSLDNPSKVPIRERDRQRSSPANLSLDSIDIGIRGQSSTSHDSFSNESDFPAKLALGSMDISGQDLDFSMVSGSPSESLPQSTRDIEAEMRRLKLELKQTMDMYSTACKEALTAKRKANELHQWKMEEARKFEEARLAEEAALAIAEMEKAKCKAAIEAAEASQRLAEMEAHRRRQAELKAKKEADEKNRALNALAHNDVRYRKYTIEEIEEATEKFSESMKIGEGGYGPVYKGKLDHTPVAIKVLRPDAAQGKKQFQQEVEVLCCIRHPNMVLLLGACPEYGCLVYEYMIHGSLEDRLFRRGNTPPLSWRKRFKIAAEIATALLFLHQAKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPSVADSVTQYHMTSAAGTFCYIDPEYQQTGMLTTKSDIYSLGIMLLQIITAKPPMGLAHHVGRAIEKGTFADMLDPAVPDWPVEEALSFAQMALKCVELRKRDRPDLGTVILPELNRLRDLGRRSDSRSYGYSSSCYSHGYSGSNQSQGQSYHSQSRSQARSSVISPLSRPRISSASQDSMSKTSDVETEPTPDSKPDDAE
Length767
PositionTail
OrganismTheobroma cacao (Cacao) (Cocoa)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Malvales> Malvaceae> Byttnerioideae> Theobroma.
Aromaticity0.06
Grand average of hydropathy-0.501
Instability index50.55
Isoelectric point7.61
Molecular weight85263.87
Publications
PubMed=23731509

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
hydrolase activity	GO:0016787	IEA:UniProtKB-KW
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP00576
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     134.37|      40|      48|     303|     350|       1
---------------------------------------------------------------------------
  289-  336 (55.83/34.64)	..........AEMRrlklelkqtmDMYSTACKEALTAKRKANELHQWKMEEARKF.....EEA
  337-  363 (25.57/28.69)	RLaeeaalaiAE.............MEKAKCKAAI..............EAA.........EA
  366-  414 (52.96/34.91)	RL........AEME.....ahrrrQAELKAKKEADEKNRALNALAHNDV.RYRKYtieeiEEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      82.95|      16|      27|     222|     237|       2
---------------------------------------------------------------------------
  172-  188 (26.36/15.98)	PPQIPLDQIeDDGIRGQ
  222-  237 (32.18/21.23)	PANLSLDSI.DIGIRGQ
  252-  265 (24.41/14.21)	PAKLALGSM.DIS..GQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     147.94|      42|     109|     507|     548|       3
---------------------------------------------------------------------------
  507-  548 (72.28/51.75)	PPLSWRKRFKIAAEIATALLFLHQAKPEPLVHRDLKPANILL
  619-  660 (75.65/54.53)	PPMGLAHHVGRAIEKGTFADMLDPAVPDWPVEEALSFAQMAL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP00576 with Med32 domain of Kingdom Viridiplantae
Unable to open file!