Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MHSIHPLDISQLSKMTGVEYMLSEVMEPNLFVIRKQKRDGPEKVTPMLAYYILDGSIYQAPQLCNVFAARVGRALYYISKAFTTAASKLEKIGYVDTENESETFESKGGKETIDFKEVKRVDHILASLQRKLPPAPPPPPFPEGFIPLATAEAEKDPENQQAVETQPPAIDPIIDQGPAKRMKF |
Length | 184 |
Position | Head |
Organism | Theobroma cacao (Cacao) (Cocoa) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Malvales> Malvaceae> Byttnerioideae> Theobroma. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.408 |
Instability index | 51.23 |
Isoelectric point | 5.69 |
Molecular weight | 20576.44 |
Publications | PubMed=23731509 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00575 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 31.05| 9| 24| 43| 52| 1 --------------------------------------------------------------------------- 43- 52 (13.78/12.71) KVTPMLaYYI 70- 78 (17.27/10.46) RVGRAL.YYI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 46.12| 15| 19| 79| 94| 2 --------------------------------------------------------------------------- 79- 94 (20.30/19.06) SKAFTTAASKlEKIGY 101- 115 (25.83/18.68) SETFESKGGK.ETIDF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AKRMKF 2) GFIPLATA 3) KRVDHILASLQRK | 179 144 119 | 184 151 131 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab