<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00570

Description COP9 signalosome complex subunit 7
SequenceMDPYSGGGSWTMIPSVPTHSNVSTPTNQDHLYLSPPPPQQQFHPQQFQQQRILHQQQQQQQNQHHQSLASHFHLLQLVENLGDAIDNGSRDQHSDALINELNNHFEKCQQLLNSIAASINTKAMTVEGQKQKLEESEQLLNQRRDLIANYGISVEDLVKTEP
Length162
PositionMiddle
OrganismTheobroma cacao (Cacao) (Cocoa)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Malvales> Malvaceae> Byttnerioideae> Theobroma.
Aromaticity0.05
Grand average of hydropathy-0.888
Instability index49.53
Isoelectric point5.58
Molecular weight18418.08
Publications
PubMed=23731509

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP00570
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.03|      16|      32|      42|      73|       1
---------------------------------------------------------------------------
   19-   34 (28.49/17.98)	HSNVSTPTNQDHLYLS
   54-   69 (29.54/ 9.68)	HQQQQQQQNQHHQSLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     102.20|      25|      27|     103|     127|       2
---------------------------------------------------------------------------
   71-  100 (23.97/11.97)	.HF.HLLQLVENLGDAIDngsrdqhSDALINE
  103-  127 (40.77/24.33)	NHFEKCQQLLNSIAASIN.......TKAMTVE
  131-  155 (37.45/21.89)	QKLEESEQLLNQRRDLIA.......NYGISVE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP00570 with Med9 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) PYSGGGSWTMIPSVPTHSNVSTPTNQDHLYLSPPPPQQQFHPQQFQQQRILHQQQQQQQNQHHQSLA
3
69










Molecular Recognition Features






MoRF SequenceStartStop




NANANA