<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00566

Description "Kinase protein with adenine nucleotide alpha hydrolases-like domain, putative isoform 2"
SequenceMAFSGSATLTMEEIPSITAVAIDRDRNSQLAVKWAVDNLLNNNTGSQCILVHVRSQSLHPHSRTDVAMNSSIGSIMGIFINYLRFLLHLTWARLVFTEDFEAVPKEGRPPTEAELQQFFLPYRGYCARKGIQSKEVVLHDIDVPSALVDYINNNNIGNIVVGASSRNVLTRKLRNPDVPTSLLKSAPESCAVYVISKGKVQFSRLASGPRTDEDNASVNRAPHIKALLSKLTFDSPKIEEFSRTVSSREGSKYRITSDRISDSFKLTPRDKLKTNNGVKSSTPSTGSQTPESPNRISISENSNFSGPPSFRSTDMSGSNSECTAEDFNSLNSLTPRGLETEMRRLRQELKKSMEMFNSVCKETVAAKEKARMLQEWKAAEERKLEEARLAEEAAMAVAEAERQKTKAAMEAAQMAQLLADMEAQKRKLAELKAIREAEAKKRALDQLANNKAVYRKYTIDEIEAATGYFASSHKIGEGGYGPVFRATLDHTAVAIKVLRPGISQGQKQFQQEVEVLSCMRHPHMVLLIGACPEYGCLVYEYMENGSLEDRLFRKDNTPSIPWKTRFRIAAEIATGLLFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPQSFADNATDYRLTAARGTFCYIDPEYQQTGMLGVKSDLYSFGVVLLQLITSRPPVGLTTQVQVAIEKRTFSEILDPTVPDWPVEEVLSLAKLALQCCELRKRDRPDLASVVLPELNRLRDLGLDYEANNSEKLVYAPRPYKSVPQIRSQESQEGMTNNPNVEMEIQT
Length784
PositionTail
OrganismTheobroma cacao (Cacao) (Cocoa)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Malvales> Malvaceae> Byttnerioideae> Theobroma.
Aromaticity0.07
Grand average of hydropathy-0.406
Instability index43.21
Isoelectric point8.29
Molecular weight87560.75
Publications
PubMed=23731509

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
hydrolase activity	GO:0016787	IEA:UniProtKB-KW
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP00566
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     298.42|      94|     110|     532|     638|       1
---------------------------------------------------------------------------
  532-  627 (160.51/125.02)	PEY...GCL.VYEYMEN.GSLEDRLFrkDNTPSIPWKTRFRIAAEIATGLLFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLV.PQ..SFADNATDY
  641-  742 (137.92/82.48)	PEYqqtGMLgVKSDLYSfGVVLLQLI..TSRPPVGLTTQVQVAIEKRTFSEILDPTVPDWPVEEVLSLAKLALQCCELRKRDRPDLASVVlPElnRLRDLGLDY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     103.11|      28|      28|     406|     433|       2
---------------------------------------------------------------------------
  365-  388 (27.08/19.26)	.AAKEKARML.QEWK..AAEERK..LEEAR.
  406-  433 (45.44/38.18)	KAAMEAAQMA.QLLADMEAQKRK..LAELKA
  435-  464 (30.59/22.88)	REA.EAKKRAlDQLANNKAVYRKytIDEIEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.72|      19|     110|      36|      56|       3
---------------------------------------------------------------------------
   36-   56 (28.71/30.77)	VDNLLNNNTGSqcILVHVRSQ
  148-  166 (34.00/26.26)	VDYINNNNIGN..IVVGASSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.83|      26|     112|     176|     223|       4
---------------------------------------------------------------------------
  191-  223 (39.17/66.44)	AVYV....ISKGKVQFSRlasgprtDEDNASVNRAPH
  494-  523 (42.66/19.74)	AIKVlrpgISQGQKQFQQ.......EVEVLSCMRHPH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      67.06|      14|      50|     276|     289|       5
---------------------------------------------------------------------------
  276-  289 (25.06/14.92)	NGVKSSTPS......TGSQT
  301-  320 (19.64/10.05)	NSNFSGPPSfrstdmSGSNS
  328-  340 (22.37/12.51)	NSLNSLTP.......RGLET
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.06|      10|      33|     138|     147|       6
---------------------------------------------------------------------------
  138-  147 (18.26/ 9.38)	LHDIDVPSAL
  173-  182 (18.81/ 9.86)	LRNPDVPTSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.96|      16|      21|     229|     244|       7
---------------------------------------------------------------------------
  229-  244 (27.32/16.15)	SKLTFDSPKI.EEFSRT
  251-  267 (22.64/12.29)	SKYRITSDRIsDSFKLT
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP00566 with Med32 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) FKLTPRDKLKTNNGVKSSTPSTGSQTPESPNRISISENSNFSGPPSFRSTDMSGSNSECTAEDFNSLNSLTPRGLETEMRRLRQELKKS
264
352










Molecular Recognition Features






MoRF SequenceStartStop




NANANA