<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00543
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASTKESDNASNSPSSPKTVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNASFRNGMAHPVNKELAHRQQFFFWKNYRNNRLKFILPKPPPEPVAAPAPLPPTAVPPQAAMPPVPATTIAMTSASPAPSSALSPMPYGLPPGSVLAKNDMRNSGIDRRKRKKEV |
| Length | 208 |
| Position | Middle |
| Organism | Theobroma cacao (Cacao) (Cocoa) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Byttnerioideae> Theobroma.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.534 |
| Instability index | 63.36 |
| Isoelectric point | 9.45 |
| Molecular weight | 23735.03 |
| Publications | PubMed=23731509
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00543
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.85| 24| 27| 131| 157| 1
---------------------------------------------------------------------------
134- 157 (47.69/20.96) PPEPVA..APAPLPPTAVPPQA.AMPP
159- 185 (35.16/ 8.85) PATTIAmtSASPAPSSALSPMPyGLPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.29| 20| 27| 31| 50| 2
---------------------------------------------------------------------------
31- 50 (36.64/27.68) FLLELEFVQCLANPTYIHYL
61- 80 (36.65/27.69) FIGYLKYLQYWQRPEYIKFI
---------------------------------------------------------------------------
|